Dynactin Subunit 1/DCTN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33976

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Dynactin Subunit 1/DCTN1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dynactin Subunit 1/DCTN1 Antibody - BSA Free

Western Blot: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Western Blot: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Western Blot: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunocytochemistry/ Immunofluorescence: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunocytochemistry/Immunofluorescence: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976] - Staining of human cell line U-251 MG shows localization to cytosol & centrosome.
Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976] - Staining of human Fallopian tube shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976] - Staining of human Cerebellum shows weak cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976] - Staining of human Cerebral cortex shows weak cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976]

Immunohistochemistry-Paraffin: Dynactin Subunit 1/DCTN1 Antibody [NBP2-33976] - Staining of human Testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and leydig cells.

Applications for Dynactin Subunit 1/DCTN1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

1:100 - 1:250
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dynactin Subunit 1/DCTN1

The DCTN1 gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein. Alternative splicing of this gene results in at least 2 functionally distinct isoforms: a ubiquitously expressed one and a brain-specific one. Based on its cytogenetic location, this gene is considered as a candidate gene for limb-girdle muscular dystrophy.

Alternate Names

DAP-150, DCTN1, DP-150, Dynactin 1, HMN7B

Gene Symbol

DCTN1

UniProt

Q14203 (Human)

Additional Dynactin Subunit 1/DCTN1 Products

Product Documents for Dynactin Subunit 1/DCTN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dynactin Subunit 1/DCTN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Microtubules

Customer Reviews for Dynactin Subunit 1/DCTN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dynactin Subunit 1/DCTN1 Antibody - BSA Free and earn rewards!

Have you used Dynactin Subunit 1/DCTN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies