dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38008

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008]

Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008]

Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008]

Immunocytochemistry/ Immunofluorescence: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008]

Immunocytochemistry/Immunofluorescence: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol.
Immunohistochemistry-Paraffin: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008]

Immunohistochemistry-Paraffin: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008]

Immunohistochemistry-Paraffin: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Staining of human fallopian tube shows strong positivity in glandular cells.

Applications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: dynein, cytoplasmic 2, light intermediate chain 1

dynein, cytoplasmic 2, light intermediate chain 1 may function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis (By similarity)

Alternate Names

CGI-60, cytoplasmic dynein 2 light intermediate chain 1, D2LICDKFZp564A033, DKFZP564A033, dynein, cytoplasmic 2, light intermediate chain 1, LIC3Dynein 2 light intermediate chain

Gene Symbol

DYNC2LI1

UniProt

Additional dynein, cytoplasmic 2, light intermediate chain 1 Products

Product Documents for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free and earn rewards!

Have you used dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...