E74 like factor 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90352

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRTIQAPTQVPVVVSPRNQQL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for E74 like factor 1 Antibody - BSA Free

Western Blot: E74 like factor 1 Antibody [NBP1-90352]

Western Blot: E74 like factor 1 Antibody [NBP1-90352]

Western Blot: E74 like factor 1 Antibody [NBP1-90352] - Analysis in human cell line HEL.
Immunohistochemistry-Paraffin: E74 like factor 1 Antibody [NBP1-90352]

Immunohistochemistry-Paraffin: E74 like factor 1 Antibody [NBP1-90352]

Immunohistochemistry-Paraffin: E74 like factor 1 Antibody [NBP1-90352] - Staining of human lymph node shows distinct nuclear positivity in germinal center cells.
E74 like factor 1 Antibody - BSA Free Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Analysis in human lymph node and skeletal muscle tissues using NBP1-90352 antibody. Corresponding ELF1 RNA-seq data are presented for the same tissues.
E74 like factor 1 Antibody - BSA Free Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Staining of human duodenum shows weak nuclear positivity in glandular cells.
E74 like factor 1 Antibody - BSA Free Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Staining of human lymph node shows moderate nuclear positivity in germinal center cells.
E74 like factor 1 Antibody - BSA Free Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
E74 like factor 1 Antibody - BSA Free Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Immunohistochemistry: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
E74 like factor 1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

Chromatin Immunoprecipitation-exo-Seq: E74 like factor 1 Antibody - BSA Free [NBP1-90352]

ChIP-Exo-Seq composite graph for Anti-ELF1 (NBP1-90352) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for E74 like factor 1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: E74 like factor 1

E74-like factor 1 (ELF1) is a member of the ETS (e26 transformation specific sequence) family of proteins, contains an ETS-domain, and shares sequence identity with the Drosophila ecdysone inducible E74 transcription factor. ETS was originally identified in the E26 retroviral isolate that led to the discovery of c-ets-1 (cellular ets-1), a cellular oncogenic transcription factor capable of transforming cells. Like ETS, ELF-1 functions as a transcription factor and has been shown to bind promoter and enhancer elements in a number of immunity responsive genes. ELF-1 is highly expressed in B-cells and appears to play an integral role in B-cell gene expression.

Alternate Names

E74-like factor 1, E74-like factor 1 (ets domain transcription factor), ETS-related transcription factor Elf-1

Gene Symbol

ELF1

Additional E74 like factor 1 Products

Product Documents for E74 like factor 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for E74 like factor 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for E74 like factor 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review E74 like factor 1 Antibody - BSA Free and earn rewards!

Have you used E74 like factor 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...