EAAT2/GLT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59632

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EAAT2/GLT1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC1A2(solute carrier family 1 (glial high affinity glutamate transporter), member 2) The peptide sequence was selected from the N terminal of SLC1A2 (NP_004162). PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29880832).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EAAT2/GLT1 Antibody - BSA Free

Western Blot: EAAT2/GLT1 Antibody [NBP1-59632]

Western Blot: EAAT2/GLT1 Antibody [NBP1-59632]

Western Blot: EAAT2/GLT1 Antibody [NBP1-59632] - Fetal Brain Lane A: Primary Antibody Lane B:Primary Antibody + Blocking Peptide Primary Antibody Concentration:1ug/ml Peptide Concentration: 5ug/ml Lysate Quantity: 25ug/lane/Lane Gel Concentration: 0.12
Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-59632]

Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-59632]

Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-59632] - Human alveolar cell.
Western Blot: EAAT2/GLT1 Antibody [NBP1-59632]

Western Blot: EAAT2/GLT1 Antibody [NBP1-59632]

Western Blot: EAAT2/GLT1 Antibody [NBP1-59632] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Western Blot: EAAT2/GLT1 Antibody [NBP1-59632]

Western Blot: EAAT2/GLT1 Antibody [NBP1-59632]

Western Blot: EAAT2/GLT1 Antibody [NBP1-59632] - WB analysis of GLT1 in Hep3B WCL. Image courtesy of anonymous customer product review.
Western Blot: EAAT2/GLT1 Antibody [NBP1-59632]

Western Blot: EAAT2/GLT1 Antibody [NBP1-59632]

Western Blot: EAAT2/GLT1 Antibody [NBP1-59632] - Human Fetal Brain lysates.
Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-59632]

Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-59632]

Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-59632] - Human Brain, cortex tissue at an antibody concentration of 5 ug/ml.

Applications for EAAT2/GLT1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EAAT2/GLT1

SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Excitatory Amino Acid Transporter 2

Alternate Names

EAAT2, GLT1, SLC1A2

Entrez Gene IDs

6506 (Human)

Gene Symbol

SLC1A2

UniProt

P43004 (Human)

Additional EAAT2/GLT1 Products

Product Documents for EAAT2/GLT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EAAT2/GLT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glial Lineage Markers

Citations for EAAT2/GLT1 Antibody - BSA Free

Customer Reviews for EAAT2/GLT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EAAT2/GLT1 Antibody - BSA Free and earn rewards!

Have you used EAAT2/GLT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EAAT2/GLT1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Can you please advise if NBP1-59632, GLT1 Antibody, will work on denatured protein?

    A: This antibody has been generated using a synthetic peptides corresponding to a sequence from the N terminal of SLC1A2 (NP_004162). PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPE. In general, the antibodies generated against partial peptides binds to proteins in their denatured form and in WB, this antibody was validated under reducing and denaturing conditions at our end. However, because the antigen sequence corresponds to the extracellular topological domain and the antibody worked perfectly in IHC as well (where protein targets are more in their native state), I assume that in WB also, this antibody should be able to detect GLT1 in its native state.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies