eEF-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54383

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all eEF-2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EEF2(eukaryotic translation elongation factor 2) The peptide sequence was selected from the N terminal of EEF2. Peptide sequence TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

94 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for eEF-2 Antibody - BSA Free

Western Blot: eEF-2 Antibody [NBP1-54383]

Western Blot: eEF-2 Antibody [NBP1-54383]

Western Blot: eEF-2 Antibody [NBP1-54383] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Immunohistochemistry-Paraffin: eEF-2 Antibody [NBP1-54383]

Immunohistochemistry-Paraffin: eEF-2 Antibody [NBP1-54383]

Immunohistochemistry-Paraffin: eEF-2 Antibody [NBP1-54383] - Human small intestine tissue at an antibody concentration of 5 ug/ml.

Applications for eEF-2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eEF-2

EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Eukaryotic Translation Elongation Factor 2

Alternate Names

eEF2

Gene Symbol

EEF2

UniProt

P13639 (Human)

Additional eEF-2 Products

Product Documents for eEF-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for eEF-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for eEF-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eEF-2 Antibody - BSA Free and earn rewards!

Have you used eEF-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

mTOR Signaling Pathway mTOR Signaling Pathway Thumbnail