eIF2B epsilon Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35116

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 442-721 of human eIF2B epsilon (eIF2B epsilon (EIF2B5)) (NP_003898.2).

Sequence:
TLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSEDD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for eIF2B epsilon Antibody - BSA Free

eIF2B epsilon Antibody

Immunoprecipitation: eIF2B epsilon Antibody [NBP3-35116] -

Immunoprecipitation: eIF2B epsilon Antibody [NBP3-35116] - Immunoprecipitation analysis of 200 ug extracts of A-549 cells using 3 ug eIF2B epsilon(eIF2B epsilon(EIF2B5)) antibody ( A10263). Western blot was performed from the immunoprecipitate using eIF2B epsilon(eIF2B epsilon(EIF2B5)) antibody ( A10263) at a dilution of 1:1000.
eIF2B epsilon Antibody

Immunocytochemistry/ Immunofluorescence: eIF2B epsilon Antibody [NBP3-35116] -

Immunocytochemistry/ Immunofluorescence: eIF2B epsilon Antibody [NBP3-35116] - Immunofluorescence analysis of L929 cells using eIF2B epsilon(eIF2B epsilon(EIF2B5)) Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
eIF2B epsilon Antibody

Western Blot: eIF2B epsilon Antibody [NBP3-35116] -

Western Blot: eIF2B epsilon Antibody [NBP3-35116] - Western blot analysis of various lysates using eIF2B epsilon(EIF2B5) Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for eIF2B epsilon Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: eIF2B epsilon

The eIF2B epsilon gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other E

Alternate Names

CACH, CLE, EIF-2B, eIF-2B GDP-GTP exchange factor subunit epsilon, EIF2BE, EIF2Bepsilon, eukaryotic translation initiation factor 2B, subunit 5 (epsilon, 82kD), eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa, LVWM, translation initiation factor eIF-2B subunit epsilon

Gene Symbol

EIF2B5

Additional eIF2B epsilon Products

Product Documents for eIF2B epsilon Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for eIF2B epsilon Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for eIF2B epsilon Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eIF2B epsilon Antibody - BSA Free and earn rewards!

Have you used eIF2B epsilon Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...