EIF3D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39069

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EIF3D Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EIF3D Antibody - BSA Free

Western Blot: EIF3D Antibody [NBP2-39069]

Western Blot: EIF3D Antibody [NBP2-39069]

Western Blot: EIF3D Antibody [NBP2-39069] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: EIF3D Antibody [NBP2-39069]

Immunocytochemistry/ Immunofluorescence: EIF3D Antibody [NBP2-39069]

Immunocytochemistry/Immunofluorescence: EIF3D Antibody [NBP2-39069] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: EIF3D Antibody [NBP2-39069]

Immunohistochemistry-Paraffin: EIF3D Antibody [NBP2-39069]

Immunohistochemistry-Paraffin: EIF3D Antibody [NBP2-39069] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Applications for EIF3D Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF3D

Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissociated state. It is also thought to play a role in the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and by promoting mRNA binding. The protein encoded by this gene is the major RNA binding subunit of the eIF3 complex. [provided by RefSeq]

Alternate Names

eIF3d, eIF3-p66, EIF3S7eIF3 p66, eIF-3-zeta, eIF3-zeta, Eukaryotic translation initiation factor 3 subunit 7, eukaryotic translation initiation factor 3 subunit D, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa, eukaryotic translation initiation factor 3, subunit D, MGC126526, MGC17258, translation initiation factor eIF3 p66 subunit

Gene Symbol

EIF3D

UniProt

O15371 (Human)

Additional EIF3D Products

Product Documents for EIF3D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EIF3D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF3D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF3D Antibody - BSA Free and earn rewards!

Have you used EIF3D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies