ELARR>GG

Catalog # Availability Size / Price Qty
6292/100U
Cat.No. 6292 - ELA RR-GG | Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Gly-Gly-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro
1 Image
Description: Negative control for ELA-32 (Cat.No.6291)
Alternative Names: ELA-32 negative control
Product Details
Supplemental Products
Reviews

Biological Activity

ELABELA mutant peptide. Negative control for ELA-32 (Cat.No.6291).

Technical Data

M.Wt:
3769.55
Formula:
C162H271N57O39S4
Sequence:
QRPVNLTMGGKLRKHNCLQRRCMPLHSRVPFP

(Modifications: Disulfide bridge: 17-22)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.

Additional Information

Other Product-Specific Information:

Product Datasheets

Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

VersaClone cDNA Plasmids

Reviews for ELARR>GG

There are currently no reviews for this product. Be the first to review ELARR>GG and earn rewards!

Have you used ELARR>GG?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.