ELA-32 (human)

Catalog #: 6291 Datasheet / COA / SDS

Discontinued Product

6291 has been discontinued.
View all Apelin Receptor Agonists products.
ELA-32 (human)
1 Image
Description: Potent and high affinity apelin agonist; stimulates angiogenesis
Alternative Names: APJ early endogenous ligand, Apela, Elabela, Toddler
Product Details
Reviews

Biological Activity

ELA-32 (human) is a potent, high affinity apelin receptor agonist (IC50 = 0.27 nM; Kd = 0.51 nM). Exhibits no binding GPR15 and GPR25. Activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. Also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. Stimulates angiogenesis in HUVEC cells. Relaxes mouse aortic vessels. Functions as an anorexigenic hormone through activation of the AVP and CRH neurons in the PVN.

Negative control (Cat.No. 6292) also available.

Technical Data

M.Wt:
3967.8
Formula:
C170H289N63O39S4
Sequence:
QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP

(Modifications: Disulfide bridge: 17-22)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
1680205-79-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Complete Your Experiment

Additional Information

Licensing Caveats:
Sold under agreement from the Agency for Science, Technology and Research (A*STAR), ETPL, and affiliates including the Institute of Medical Biology.
Other Product-Specific Information:

Product Datasheets

Or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for ELA-32 (human)

There are currently no reviews for this product. Be the first to review ELA-32 (human) and earn rewards!

Have you used ELA-32 (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.