ELAVL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38012

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ELAVL2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ELAVL2 Antibody - BSA Free

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012] - Staining in human cerebral cortex and skeletal muscle tissues using NBP2-38012 antibody. Corresponding ELAVL2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: ELAVL2 Antibody [NBP2-38012]

Immunocytochemistry/ Immunofluorescence: ELAVL2 Antibody [NBP2-38012]

Immunocytochemistry/Immunofluorescence: ELAVL2 Antibody [NBP2-38012] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012]

Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Applications for ELAVL2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ELAVL2

Hu-antigen B (HuB), ELAV-like protein 2, ELAV-like neuronal protein 1, Nervous system-specific RNA binding protein Hel-N1 is a transcription factor belonging to the ELAV family of RNP proteins. It binds RNA and seems to recognize a GAAA motif and is neuronal specific.

Alternate Names

ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B), ELAV-like neuronal protein 1, ELAV-like protein 2, HELN1, HEL-N1, Hu-antigen B, HuB, HUBELAV (embryonic lethal, abnormal vision, Drosophila)-like 2, Nervous system-specific RNA-binding protein Hel-N1

Gene Symbol

ELAVL2

Additional ELAVL2 Products

Product Documents for ELAVL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ELAVL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ELAVL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ELAVL2 Antibody - BSA Free and earn rewards!

Have you used ELAVL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies