ELSPBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13957

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: SCISQGSFLGSLWWSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ELSPBP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Analysis in human epididymis and prostate tissues. Corresponding ELSPBP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human cerebral cortex, epididymis, prostate and testis using Anti-ELSPBP1 antibody NBP2-13957 (A) shows similar protein distribution across tissues to independent antibody NBP2-13958 (B).
Western Blot: ELSPBP1 Antibody [NBP2-13957]

Western Blot: ELSPBP1 Antibody [NBP2-13957]

Western Blot: ELSPBP1 Antibody [NBP2-13957] - Analysis in control (vector only transfected HEK293T lysate) and ELSPBP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human epididymis shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957]

Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human prostate shows no positivity in glandular cells as expected.

Applications for ELSPBP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ELSPBP1

The protein encoded by the ELSPBP1 gene belongs to the sperm-coating protein family of epididymal origin. This protein and itscanine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domainsin the Fn2-module protein family. (provided by RefSeq)

Alternate Names

E12epididymal protein 12, EDDM12, Epididymal secretory protein 12, epididymal sperm binding protein 1, epididymal sperm-binding protein 1, HE12

Gene Symbol

ELSPBP1

Additional ELSPBP1 Products

Product Documents for ELSPBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ELSPBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ELSPBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ELSPBP1 Antibody - BSA Free and earn rewards!

Have you used ELSPBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...