EMR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35252

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EMR1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 477-596 of human EMR1 (NP_001965.3).

Sequence:
GVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EMR1 Antibody - BSA Free

EMR1 Antibody

Immunocytochemistry/ Immunofluorescence: EMR1 Antibody [NBP3-35252] -

Immunocytochemistry/ Immunofluorescence: EMR1 Antibody [NBP3-35252] - Immunofluorescence analysis of THP-1 cells using EMR1 Rabbit pAb at dilution of 1:25 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EMR1 Antibody

Immunocytochemistry/ Immunofluorescence: EMR1 Antibody [NBP3-35252] -

Immunocytochemistry/ Immunofluorescence: EMR1 Antibody [NBP3-35252] - Immunofluorescence analysis of RAW264.7 cells using EMR1 Rabbit pAb at dilution of 1:25 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EMR1 Antibody

Western Blot: EMR1 Antibody [NBP3-35252] -

Western Blot: EMR1 Antibody [NBP3-35252] - Western blot analysis of lysates from Mouse lung, using EMR1 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
EMR1 Antibody

Immunocytochemistry/ Immunofluorescence: EMR1 Antibody [NBP3-35252] -

Immunocytochemistry/ Immunofluorescence: EMR1 Antibody [NBP3-35252] - Immunofluorescence analysis of paraffin-embedded Mouse spleen using EMR1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for EMR1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EMR1

This gene encodes a protein that has a domain resembling seven transmembrane G protein-coupled hormone receptors (7TM receptors) at its C-terminus. The N-terminus of the encoded protein has six EGF-like modules, separated from the transmembrane segments by a serine/threonine-rich domain, a feature reminiscent of mucin-like, single-span, integral membrane glycoproteins with adhesive properties.

Long Name

EGF-like Module Containing, Mucin-like, Hormone Receptor-like 1

Alternate Names

ADGRE1, TM7LN3

Gene Symbol

ADGRE1

Additional EMR1 Products

Product Documents for EMR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EMR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EMR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EMR1 Antibody - BSA Free and earn rewards!

Have you used EMR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies