EMR4P Antibody (2H8) - Azide and BSA Free

Novus Biologicals | Catalog # H00326342-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2H8

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

EMR4 (XP_377506, 21 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG

Reactivity Notes

Human. Other species not tested.

Specificity

EMR4 - egf-like module containing, mucin-like, hormone receptor-like 4

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for EMR4P Antibody (2H8) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: EMR4P Antibody (2H8) [H00326342-M01]

Immunocytochemistry/ Immunofluorescence: EMR4P Antibody (2H8) [H00326342-M01]

Immunocytochemistry/Immunofluorescence: EMR4P Antibody (2H8) [H00326342-M01] - Analysis of monoclonal antibody to EMR4P on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: EMR4P Antibody (2H8) [H00326342-M01] - Detection limit for recombinant GST tagged EMR4 is approximately 0.03ng/ml as a capture antibody.

Applications for EMR4P Antibody (2H8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: EMR4

This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. Thus, the protein would lack a transmembrane domain and the protein encoded by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, the possibility also exists that this gene may represent a transcribed pseudogene.

Long Name

EGF-like Module Containing, Mucin-like, Hormone Receptor-like 4

Alternate Names

Egf-tm7, Fire, Gpr127, PGR16

Entrez Gene IDs

326342 (Human)

Gene Symbol

ADGRE4P

Additional EMR4 Products

Product Documents for EMR4P Antibody (2H8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EMR4P Antibody (2H8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EMR4P Antibody (2H8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review EMR4P Antibody (2H8) - Azide and BSA Free and earn rewards!

Have you used EMR4P Antibody (2H8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...