Enolase 2/Neuron-specific Enolase Antibody (9B4Y4)
Novus Biologicals | Catalog # NBP3-15659
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 9B4Y4 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 47-100 of human Enolase 2/Neuron-specific Enolase (NP_001966.1). LELRDGDKQRYLGKGVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANA
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Enolase 2/Neuron-specific Enolase Antibody (9B4Y4)
Western Blot: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] -
Western Blot: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] - Western blot analysis of various lysates using Enolase 2/Neuron-specific Enolase Rabbit mAb at 1:10000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Negative control (NC): U-937
Exposure time: 15s.
Immunocytochemistry/ Immunofluorescence: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] -
Immunocytochemistry/ Immunofluorescence: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] - Confocal imaging of Neuro-2a cells using Enolase 2/Neuron-specific Enolase Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunohistochemistry: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] -
Immunohistochemistry: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Enolase 2/Neuron-specific Enolase Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] -
Immunohistochemistry: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Enolase 2/Neuron-specific Enolase Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] -
Immunohistochemistry: Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) [Enolase 2/Neuron-specific Enolase] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using Enolase 2/Neuron-specific Enolase Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Applications for Enolase 2/Neuron-specific Enolase Antibody (9B4Y4)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
1:2000 - 1:10000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Enolase 2/Neuron-specific Enolase
Alternate Names
ENO2, gamma-Enolase, Neuronspecific Enolase, NSE
Gene Symbol
ENO2
Additional Enolase 2/Neuron-specific Enolase Products
Product Documents for Enolase 2/Neuron-specific Enolase Antibody (9B4Y4)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Enolase 2/Neuron-specific Enolase Antibody (9B4Y4)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Enolase 2/Neuron-specific Enolase Antibody (9B4Y4)
There are currently no reviews for this product. Be the first to review Enolase 2/Neuron-specific Enolase Antibody (9B4Y4) and earn rewards!
Have you used Enolase 2/Neuron-specific Enolase Antibody (9B4Y4)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...