Enolase 2/Neuron-specific Enolase Antibody (SPM347)

Novus Biologicals | Catalog # NBP2-53158

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # SPM347
Loading...

Product Specifications

Immunogen

A synthetic peptide of human Enolase 2/Neuron-specific Enolase (around aa416-433; exact sequence is proprietary) (Uniprot: P09104)

Localization

Cytoplasmic

Marker

Neuroendocrine Marker

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

200ug/ml of antibody purified from Bioreactor Concentrate by Protein A or G. Prepared in 10 mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0 mg/ml. (NBP2-54590)

Antibody with azide - store at 2 to 8C. Antibody without azide - store at -20 to -80C.

Scientific Data Images for Enolase 2/Neuron-specific Enolase Antibody (SPM347)

Immunohistochemistry-Paraffin: Enolase 2/Neuron-specific Enolase Antibody (SPM347) [NBP2-53158]

Immunohistochemistry-Paraffin: Enolase 2/Neuron-specific Enolase Antibody (SPM347) [NBP2-53158]

Immunohistochemistry-Paraffin: Enolase 2/Neuron-specific Enolase Antibody (SPM347) [NBP2-53158] - Formalin-fixed, paraffin-embedded Human Pheochromocytoma stained with NSE gamma Monoclonal Antibody (SPM347).

Applications for Enolase 2/Neuron-specific Enolase Antibody (SPM347)

Application
Recommended Usage

Flow Cytometry

1-2 ug/million cells

Immunocytochemistry/ Immunofluorescence

1-2 ug/ml

Immunohistochemistry-Paraffin

0.1-0.2 ug/ml

Western Blot

1-2 ug/ml
Application Notes
Immunohistochemistry (Formalin-fixed): 0.1-0.2ug/ml for 30 min at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes.
Optimal dilution for a specific application should be determined.

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

10 mM PBS with 0.05% BSA

Preservative

0.05% Sodium Azide

Concentration

0.2 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C.

Background: Enolase 2/Neuron-specific Enolase

Neuron-specific enolase (NSE) is a glycolytic isoenzyme which is located in central and peripheral neurons and neuroendocrine cells. This enzyme is released into the CSF when neural tissue is injured. Neoplasms derived from neural or neuroendocrine tissue may release NSE into the blood. NSE is a useful substance that has been detected in patients with certain tumors, namely: neuroblastoma, small cell lung cancer, medullary thyroid cancer, carcinoid tumors, pancreatic endocrine tumors, and melanoma. Recombinant NSE was expressed in E.coli and purified by conventional chromatography techniques.

Alternate Names

ENO2, gamma-Enolase, Neuronspecific Enolase, NSE

Gene Symbol

ENO2

UniProt

Additional Enolase 2/Neuron-specific Enolase Products

Product Documents for Enolase 2/Neuron-specific Enolase Antibody (SPM347)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Enolase 2/Neuron-specific Enolase Antibody (SPM347)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Enolase 2/Neuron-specific Enolase Antibody (SPM347)

There are currently no reviews for this product. Be the first to review Enolase 2/Neuron-specific Enolase Antibody (SPM347) and earn rewards!

Have you used Enolase 2/Neuron-specific Enolase Antibody (SPM347)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Enolase 2/Neuron-specific Enolase Antibody (SPM347)

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Enolase came up as a candidate in mass spec. There are at least three isoforms which showed up once or twice or three times (as in three mass spec repeats). To validate the mass data, we are looking into quantitate each isoform. Which antibodies are specific for each of the three?

    A: We checked all antibodies to Enolase 1, Enolase 2 and Enolase 3, but unfortunately no cross reactivity testing was performed for any of these antibodies. Considering how similar these proteins are, it is reasonable to expect some of them will react with other enolases. Base on immunogen sequence, we found some that were raised to the most diverse regions between these proteins, so it is possible that these will be the most  specific to the protein they were raised to.

    For Enolase 1, your best bet is NBP2-25147  as it was raised to N terminal peptide of bovine Eno1: MSILKVHAREIF

    For Enolase 2, I found 3 candidate antibodies:
    NBP2-53158  and NBP2-50532  were raised to aa416-433 (ELGDEARFAGHNFRNPSVL) - it says these antibodies are only reactive with human but they will also work for mouse since the immunogen is 100% match
    NBP2-50533, which was raised to aa271-285 (GDQLGALYQDFVRD) - which is also likely to react with mouse, the immunogen is 93% match with mouse (only last aminoacid is different)

    For Enolase 3, your best bet would be H00002027-M01 or H00002027-A01. both were raised to aa228-277 (KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG) - 98% match to mouse

    The immunogens for all these antibodies fall into most variable regions, however, since we have not performed crossreactivity testing, we can not guarantee that they will not crossreact to some extent.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...