epithelial Sodium Channel gamma Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35497

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all epithelial Sodium Channel gamma Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human epithelial Sodium Channel gamma (NP_001030.2).

Sequence:
CNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for epithelial Sodium Channel gamma Antibody - BSA Free

epithelial Sodium Channel gamma Antibody

Western Blot: epithelial Sodium Channel gamma Antibody [NBP3-35497] -

Western Blot: epithelial Sodium Channel gamma Antibody [NBP3-35497] - Western blot analysis of various lysates using epithelial Sodium Channel gamma Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
epithelial Sodium Channel gamma Antibody

Immunocytochemistry/ Immunofluorescence: epithelial Sodium Channel gamma Antibody [NBP3-35497] -

Immunocytochemistry/ Immunofluorescence: epithelial Sodium Channel gamma Antibody [NBP3-35497] - Immunofluorescence analysis of paraffin-embedded mouse kidney using epithelial Sodium Channel gamma Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
epithelial Sodium Channel gamma Antibody

Immunocytochemistry/ Immunofluorescence: epithelial Sodium Channel gamma Antibody [NBP3-35497] -

Immunocytochemistry/ Immunofluorescence: epithelial Sodium Channel gamma Antibody [NBP3-35497] - Immunofluorescence analysis of paraffin-embedded human kidney cancer using epithelial Sodium Channel gamma Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for epithelial Sodium Channel gamma Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: epithelial Sodium Channel gamma

Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the gamma subunit, and mutations in this gene have been associated with Liddle syndrome. [provided by RefSeq]

Long Name

Amiloride-sensitive sodium channel subunit gamma

Alternate Names

ENaCG, Gamma-ENaC, Gamma-NaCH, SCNEG, SCNN1G

Gene Symbol

SCNN1G

Additional epithelial Sodium Channel gamma Products

Product Documents for epithelial Sodium Channel gamma Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for epithelial Sodium Channel gamma Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for epithelial Sodium Channel gamma Antibody - BSA Free

There are currently no reviews for this product. Be the first to review epithelial Sodium Channel gamma Antibody - BSA Free and earn rewards!

Have you used epithelial Sodium Channel gamma Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies