epsilon-Sarcoglycan Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59794

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all epsilon-Sarcoglycan Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SGCE(sarcoglycan, epsilon) The peptide sequence was selected from the N terminal of SGCE. Peptide sequence TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for epsilon-Sarcoglycan Antibody - BSA Free

Western Blot: epsilon-Sarcoglycan Antibody [NBP1-59794]

Western Blot: epsilon-Sarcoglycan Antibody [NBP1-59794]

Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SGCE is supported by BioGPS gene expression data to be expressed in 721_B
Immunohistochemistry: epsilon-Sarcoglycan Antibody [NBP1-59794]

Immunohistochemistry: epsilon-Sarcoglycan Antibody [NBP1-59794]

Immunohistochemistry: SGCE Antibody [NBP1-59794] - pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0 ug/ml using anti-SGCE antibody
Western Blot: epsilon-Sarcoglycan Antibody [NBP1-59794]

Western Blot: epsilon-Sarcoglycan Antibody [NBP1-59794]

Western Blot: SGCE Antibody [NBP1-59794] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: epsilon-Sarcoglycan Antibody [NBP1-59794]

Western Blot: epsilon-Sarcoglycan Antibody [NBP1-59794]

Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: epsilon-Sarcoglycan Antibody [NBP1-59794]

Western Blot: epsilon-Sarcoglycan Antibody [NBP1-59794]

Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: epsilon-Sarcoglycan Antibody [NBP1-59794]

Immunohistochemistry-Paraffin: epsilon-Sarcoglycan Antibody [NBP1-59794]

Immunohistochemistry-Paraffin: SGCE Antibody [NBP1-59794] - Mouse cerebellum tissue, 1:500 dilution.

Applications for epsilon-Sarcoglycan Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: epsilon-Sarcoglycan

SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix. Mutations in this gene have been associated with myoclonus-dystonia syndrome. Alternative splicing results in multiple transcript variants.The SGCE gene encodes the epsilon member of the sarcoglycan family, transmembrane components of the dystrophin-glycoprotein complex, which links the cytoskeleton to the extracellular matrix.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Sarcoglycan epsilon, SGCE

Gene Symbol

SGCE

Additional epsilon-Sarcoglycan Products

Product Documents for epsilon-Sarcoglycan Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for epsilon-Sarcoglycan Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cardiac Stem Cell Markers
Proteoglycans

Customer Reviews for epsilon-Sarcoglycan Antibody - BSA Free

There are currently no reviews for this product. Be the first to review epsilon-Sarcoglycan Antibody - BSA Free and earn rewards!

Have you used epsilon-Sarcoglycan Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies