ERO1L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84800

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Rat

Predicted:

Mouse (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ERO1L Antibody - BSA Free

Western Blot: ERO1L Antibody [NBP1-84800]

Western Blot: ERO1L Antibody [NBP1-84800]

Western Blot: ERO1L Antibody [NBP1-84800] - Analysis using Anti-ERO1A antibody NBP1-84800 (A) shows similar pattern to independent antibody NBP1-84799 (B).
ERO1L Antibody - BSA Free Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Staining of human small intestine shows weak granular cytoplasmic positivity in glandular cells.
ERO1L Antibody - BSA Free Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
ERO1L Antibody - BSA Free Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Staining of human placenta, skeletal muscle, small intestine and squamous epithelia using Anti-ERO1A antibody NBP1-84800 (A) shows similar protein distribution across tissues to independent antibody HPA030053 (B).

Staining of human placenta, skeletal muscle, small intestine and squamous epithelia using Anti-ERO1A antibody HPA026653 (A) shows similar protein distribution across tissues to independent antibody HPA030053 (B).
ERO1L Antibody - BSA Free Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Staining of human esophagus shows strong granular cytoplasmic positivity in squamous epithelial cells.
ERO1L Antibody - BSA Free Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Analysis in human esophagus and skeletal muscle tissues using HPA026653 antibody. Corresponding ERO1A RNA-seq data are presented for the same tissues.
ERO1L Antibody - BSA Free Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Staining of human tonsil shows moderate granular cytoplasmic positivity in squamous epithelial cells.
ERO1L Antibody - BSA Free Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Immunohistochemistry-Paraffin: ERO1L Antibody - BSA Free [NBP1-84800]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
ERO1L Antibody - BSA Free Western Blot: ERO1L Antibody - BSA Free [NBP1-84800]

Western Blot: ERO1L Antibody - BSA Free [NBP1-84800]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for ERO1L Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ERO1L alpha

Perhaps the most distinctive feature of protein folding in the ER is the abundance of disulfide bonds that must form during maturation of proteins traveling along the secretory pathway. Formation of disulfide bonds is a redox reaction. Thus, to match the flux of disulfide bonds that exit from the ER by virtue of protein secretion, a flux of oxidizing equivalents into the ER is required. In eukaryotic cells, the essential protein relay supporting this flux, and hence disulfide bond formation, involves endoplasmic reticulum oxidoreductin 1 (Ero1) and protein disulfide isomerase (PDI). The temporal pattern of hypoxic ERO1-L alpha induction is very similar to that of genes triggered by the hypoxia inducible transcription factor (HIF-1) and is characteristically mimicked by cobalt and by deferoxamine, but is absent in cells with a defective aryl hydrocarbon receptor translocator (ARNT, HIF-1 alpha). We speculate from these findings that the expression of ERO1-L alpha is probably regulated via the HIF-pathway and thus belongs to the family of classic oxygen regulated genes.

Long Name

Endoplasmic Reticulum Oxidoreductin 1 alpha

Alternate Names

ERO1-alpha, ERO1-L, ERO1-l alpha, ERO1-like, ERO1-like alpha, ERO1A, ERO1L

Gene Symbol

ERO1A

Additional ERO1L alpha Products

Product Documents for ERO1L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ERO1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for ERO1L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ERO1L Antibody - BSA Free and earn rewards!

Have you used ERO1L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...