ERP27 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88393

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ERP27 Antibody - BSA Free

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining in human pancreas and colon tissues using anti-ERP27 antibody. Corresponding ERP27 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human testis.
Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human colon, liver, pancreas and testis using Anti-ERP27 antibody NBP1-88393 (A) shows similar protein distribution across tissues to independent antibody NBP2-38679 (B).
Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393]

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human liver.
ERP27 Antibody - BSA Free Western Blot: ERP27 Antibody - BSA Free [NBP1-88393]

Western Blot: ERP27 Antibody - BSA Free [NBP1-88393]

Analysis in control (vector only transfected HEK293T lysate) and ERP27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for ERP27 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ERP27

ERP27 is a noncatalytic member of the protein disulfide isomerase (PDI; see MIM 608012) family of endoplasmic reticulum (ER) proteins (Alanen et al., 2006 [PubMed 16940051]).[supplied by OMIM]

Alternate Names

C12orf46, chromosome 12 open reading frame 46, endoplasmic reticulum protein 27, endoplasmic reticulum protein 27 kDa, endoplasmic reticulum resident protein 27, ER protein 27, ERp27, FLJ32115, PDIA8, protein disulfide isomerase family A, member 8

Gene Symbol

ERP27

Additional ERP27 Products

Product Documents for ERP27 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ERP27 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ERP27 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ERP27 Antibody - BSA Free and earn rewards!

Have you used ERP27 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...