ERP29 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88395

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ERP29 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Marker

Endoplasmic Reticulum Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ERP29 Antibody - BSA Free

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395] - Staining in human prostate and skeletal muscle tissues using anti-ERP29 antibody. Corresponding ERP29 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395] - Staining of human skeletal muscle using Anti-ERP29 antibody NBP1-88395.
Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395] - Staining of human cerebral cortex, lymph node, prostate and skeletal muscle using Anti-ERP29 antibody NBP1-88395 (A) shows similar protein distribution across tissues to independent antibody NBP1-88396 (B).
Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395] - Staining of human lymph node.
Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88395] - Staining of human prostate using Anti-ERP29 antibody NBP1-88395.
ERP29 Antibody - BSA Free Immunohistochemistry-Paraffin: ERP29 Antibody - BSA Free [NBP1-88395]

Immunohistochemistry-Paraffin: ERP29 Antibody - BSA Free [NBP1-88395]

Staining of human skeletal muscle shows low expression as expected.
ERP29 Antibody - BSA Free Western Blot: ERP29 Antibody - BSA Free [NBP1-88395]

Western Blot: ERP29 Antibody - BSA Free [NBP1-88395]

Analysis using Anti-ERP29 antibody NBP1-88395 (A) shows similar pattern to independent antibody NBP1-88396 (B).

Applications for ERP29 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ERP29

ERP29 encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

C12orf8chromosome 12 open reading frame 8, endoplasmic reticulum lumenal protein ERp28, endoplasmic reticulum protein 29, Endoplasmic reticulum resident protein 28, endoplasmic reticulum resident protein 29, ERp28Endoplasmic reticulum resident protein 31, ERp29, ERp31ERP28, PDIA9, PDI-DB, protein disulfide isomerase family A, member 9

Gene Symbol

ERP29

Additional ERP29 Products

Product Documents for ERP29 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ERP29 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ERP29 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ERP29 Antibody - BSA Free and earn rewards!

Have you used ERP29 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies