EWSR1 Antibody (9G3H1)

Novus Biologicals | Catalog # NBP3-16845

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9G3H1 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human EWSR1 (Q01844). MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EWSR1 Antibody (9G3H1)

Western Blot: EWSR1 Antibody (9G3H1) [NBP3-16845]

Western Blot: EWSR1 Antibody (9G3H1) [NBP3-16845]

Western Blot: EWSR1 Antibody (9G3H1) [NBP3-16845] - Western blot analysis of extracts of various cell lines, using EWSR1 Rabbit mAb (NBP3-16845) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845]

Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845]

Immunocytochemistry/Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunofluorescence analysis of U-2 OS cells using EWSR1 Rabbit mAb (NBP3-16845) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845]

Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845]

Immunocytochemistry/Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunofluorescence analysis of C6 cells using EWSR1 Rabbit mAb (NBP3-16845) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845]

Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845]

Immunocytochemistry/Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunofluorescence analysis of NIH-3T3 cells using EWSR1 Rabbit mAb (NBP3-16845) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human breast cancer tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded rat colon tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse kidney tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse lung tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse colon tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human thyroid tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded rat spleen tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human tonsil tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human breast tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse heart tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EWSR1 Antibody (9G3H1)

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse liver tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for EWSR1 Antibody (9G3H1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EWSR1

The EWSR1 gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal

Long Name

RNA-binding protein EWS

Alternate Names

EWS, EWS oncogene

Gene Symbol

EWSR1

Additional EWSR1 Products

Product Documents for EWSR1 Antibody (9G3H1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EWSR1 Antibody (9G3H1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EWSR1 Antibody (9G3H1)

There are currently no reviews for this product. Be the first to review EWSR1 Antibody (9G3H1) and earn rewards!

Have you used EWSR1 Antibody (9G3H1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...