Exendin-3 (9-39) amide (CAS 133514-43-9): R&D Systems
Catalog Number: 2081
Biological Activity
Potent and selective GLP-1 receptor antagonist (Kd = 1.7 nM at cloned human GLP-1 receptors). Inhibits cAMP production and insulin release induced by GLP-1 (7-36), exendin-3 (IC50 = 20 nM) and exendin-4. Blocks the inhibitory effect of GLP-1 on food intake in rats.
Technical Data
  • M.Wt:
    3369.79
  • Formula:
    C149H234N40O47S
  • Sequence:
    DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    (Modifications: Ser-31 = C-terminal amide)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    133514-43-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting β-cells.
    Goke et al.
    J.Biol.Chem., 1993;268:19650
  2. Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.
    Thorens et al.
    Diabetes, 1993;42:1678
  3. A role for glucagon-like peptide-1 in the central regulation of feeding.
    Turton et al.
    Nature, 1996;379:69
  4. Exendin-3, a novel peptide from the Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas.
    Raufman et al.
    J.Biol.Chem., 1991;266:2897
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Exendin-3 (9-39) amide include:

3 Citations: Showing 1 - 3
Filter your results:

  1. GLP-1 acts on habenular avoidance circuits to control nicotine intake.
    Authors: Tuesta
    Nat Neurosci 2017;20(5):708
  2. Negative Energy Balance Blocks Neural and Behavioral Responses to Acute Stress by " Silencing" Central Glucagon-Like Peptide 1 Signaling in Rats.
    Authors: Maniscalco Et al.
    Emerg Microbes Infect 2015;35:10701
  3. The role of the gut hormone GLP-1 in the metabolic improvements caused by ileal transposition.
    Authors: Gaitonde Et al.
    J Surg Res 2012;178:33

Have you used Exendin-3 (9-39) amide?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information