Exosome component 10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82448

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Exosome component 10 Antibody - BSA Free

Western Blot: Exosome component 10 Antibody [NBP1-82448]

Western Blot: Exosome component 10 Antibody [NBP1-82448]

Western Blot: Exosome component 10 Antibody [NBP1-82448] - Analysis in control (vector only transfected HEK293T lysate) and EXOSC10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Skin shows moderate nuclear positivity in squamous epithelial cells.
Western Blot: Exosome component 10 Antibody [NBP1-82448]

Western Blot: Exosome component 10 Antibody [NBP1-82448]

Western Blot: Exosome component 10 Antibody [NBP1-82448] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EXOSC10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human esophagus shows strong nucleolar positivity in superficial squamous epithelial cells.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Cerebral cortex shows moderate nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448]

Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Testis shows moderate nuclear positivity in cells in seminiferous ducts and leydig cells.

Applications for Exosome component 10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Exosome component 10

Part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions. Required for the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA. Could be an exonuclease. Plays a role in replication-dependent histone mRNA degradation. Mediates the association of MTR4, C1D and MPP6 wth the exosome and this complex is required for the maturation of 5.8S rRNA. Required for nucleolar localization of C1D

Alternate Names

autoantigen PM-SCL, EC 3.1.13.-, exosome component 10, P100 polymyositis-scleroderma overlap syndrome-associated autoantigen, p2, p3, p4, PM/Scl-100Autoantigen PM/Scl 2, PM-Scl, PMSCL2PMSCL, Polymyositis/scleroderma autoantigen 2, polymyositis/scleroderma autoantigen 2 (100kD), polymyositis/scleroderma autoantigen 2, 100kDa, RRP6, Rrp6p, RRP6Polymyositis/scleroderma autoantigen 100 kDa

Gene Symbol

EXOSC10

Additional Exosome component 10 Products

Product Documents for Exosome component 10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Exosome component 10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Exosome component 10 Antibody - BSA Free

Customer Reviews for Exosome component 10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Exosome component 10 Antibody - BSA Free and earn rewards!

Have you used Exosome component 10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...