FAM107A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30589

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FAM107A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEER

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FAM107A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: FAM107A Antibody [NBP2-30589]

Immunocytochemistry/ Immunofluorescence: FAM107A Antibody [NBP2-30589]

Immunocytochemistry/Immunofluorescence: FAM107A Antibody [NBP2-30589] - Staining of human cell line HUVEC TERT2 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining in human fallopian tube and liver tissues. Corresponding FAM107A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human cerebellum shows moderate to strong positivity.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human fallopian tube shows nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human hippocampus shows moderate to strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589]

Immunohistochemistry-Paraffin: FAM107A Antibody [NBP2-30589] - Staining of human prostate shows moderate nuclear positivity.

Applications for FAM107A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM107A

FAM107A (Family With Sequence Similarity 107, Member A) is thought to have a role in tumor suppression. FAM107A is known to have interactions with CCDC85B, KRT15, NINL, TRIM37 and EFEMP2. FAM107A has been studied in relation to renal cell carcinoma, rheumatoid arthritis, meningioma, neuroblastoma and several other diseases.

Alternate Names

downregulated in renal cell carcinoma, DRR1family with sequence similarity 107 member A transcript, family with sequence similarity 107, member A, FLJ30158, FLJ45473, Protein TU3A, TU3ADown-regulated in renal cell carcinoma 1

Gene Symbol

FAM107A

UniProt

O95990 (Human)

Additional FAM107A Products

Product Documents for FAM107A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FAM107A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FAM107A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAM107A Antibody - BSA Free and earn rewards!

Have you used FAM107A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies