FAM155A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90982

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FAM155A Antibody - BSA Free

FAM155A Antibody

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] -

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] -Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-90982 antibody. Corresponding FAM155A RNA-seq data are presented for the same tissues.
Western Blot: FAM155A Antibody [NBP1-90982]

Western Blot: FAM155A Antibody [NBP1-90982]

Western Blot: FAM155A Antibody [NBP1-90982] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982]

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982]

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining of human cerebral cortex shows high expression.
FAM155A Antibody

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] -

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining of human small intestine shows moderate membranous positivity in glandular cells.
FAM155A Antibody

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] -

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] -Staining of human skin shows no positivity in squamous epithelial cells as expected.
FAM155A Antibody

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] -

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] -Staining of human skeletal muscle shows no positivity in myocytes as expected.
FAM155A Antibody - BSA Free Immunohistochemistry: FAM155A Antibody - BSA Free [NBP1-90982]

Immunohistochemistry: FAM155A Antibody - BSA Free [NBP1-90982]

Staining of human skin shows no positivity in squamous epithelial cells as expected.
FAM155A Antibody - BSA Free Western Blot: FAM155A Antibody - BSA Free [NBP1-90982]

Western Blot: FAM155A Antibody - BSA Free [NBP1-90982]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
FAM155A Antibody - BSA Free Immunohistochemistry: FAM155A Antibody - BSA Free [NBP1-90982]

Immunohistochemistry: FAM155A Antibody - BSA Free [NBP1-90982]

Staining of human cerebral cortex shows strong cytoplasmic/ cytoplasmic membranous positivity in neuropil.
FAM155A Antibody - BSA Free Immunohistochemistry: FAM155A Antibody - BSA Free [NBP1-90982]

Immunohistochemistry: FAM155A Antibody - BSA Free [NBP1-90982]

Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-90982 antibody. Corresponding FAM155A RNA-seq data are presented for the same tissues.

Applications for FAM155A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM155A

Alternate Names

family with sequence similarity 155, member A

Gene Symbol

NALF1

Additional FAM155A Products

Product Documents for FAM155A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FAM155A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FAM155A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAM155A Antibody - BSA Free and earn rewards!

Have you used FAM155A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...