FAM170A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32706

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FAM170A Antibody - BSA Free

Western Blot: FAM170A Antibody [NBP2-32706]

Western Blot: FAM170A Antibody [NBP2-32706]

Western Blot: FAM170A Antibody [NBP2-32706] - Analysis in control (vector only transfected HEK293T lysate) and FAM170A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: FAM170A Antibody [NBP2-32706]

Immunohistochemistry-Paraffin: FAM170A Antibody [NBP2-32706]

Immunohistochemistry-Paraffin: FAM170A Antibody [NBP2-32706] - Staining in human testis and endometrium tissues using anti-FAM170A antibody. Corresponding FAM170A RNA-seq data are presented for the same tissues.
Immunohistochemistry: FAM170A Antibody [NBP2-32706]

Immunohistochemistry: FAM170A Antibody [NBP2-32706]

Immunohistochemistry: FAM170A Antibody [NBP2-32706] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: FAM170A Antibody [NBP2-32706]

Immunohistochemistry-Paraffin: FAM170A Antibody [NBP2-32706]

Immunohistochemistry-Paraffin: FAM170A Antibody [NBP2-32706] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: FAM170A Antibody [NBP2-32706]

Immunohistochemistry-Paraffin: FAM170A Antibody [NBP2-32706]

Immunohistochemistry-Paraffin: FAM170A Antibody [NBP2-32706] - Staining of human testis shows high expression.

Applications for FAM170A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM170A

FAM170A, also known as Protein FAM170A, has a 330 amino acid long isoform that is 37 kDa, an 329 amino acid isoform that is 37 kDa, an 282 amino acid isoform that is 32kDa, and a shorter 244 amino acid isoform that is 28 kDa, is a member of the FAM170 family. FAM170A can also be called Zinc finger domain-containing protein.

Alternate Names

family with sequence similarity 170, member A, Znf domain containing protein

Gene Symbol

FAM170A

Additional FAM170A Products

Product Documents for FAM170A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FAM170A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FAM170A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAM170A Antibody - BSA Free and earn rewards!

Have you used FAM170A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...