FAM60A Antibody - Azide and BSA Free
Novus Biologicals | Catalog # H00058516-B02P
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Immunohistochemistry-Paraffin, Western Blot, IF/IHC, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Mouse IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
FAM60A (NP_067061.1, 1 a.a. - 221 a.a.) full-length human protein. MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
Clonality
Polyclonal
Host
Mouse
Isotype
IgG
Scientific Data Images for FAM60A Antibody - Azide and BSA Free
Western Blot: FAM60A Antibody [H00058516-B02P]
Western Blot: FAM60A Antibody [H00058516-B02P] - Analysis of FAM60A expression in transfected 293T cell line by FAM60A polyclonal antibody. Lane 1: FAM60A transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: FAM60A Antibody [H00058516-B02P]
Immunocytochemistry/Immunofluorescence: FAM60A Antibody [H00058516-B02P] - Analysis of purified antibody to FAM60A on HeLa cell. (antibody concentration 30 ug/ml)Western Blot: FAM60A Antibody - Azide and BSA Free [H00058516-B02P] -
FAM60A is a repressor of ferroptosis. (A) The viability of cells treated with different concentrations of erastin in FAM60A-knockdown AsPC-1 cells was assessed; n = 3. (B) Effects of ferroptosis inhibitor Ferrostatin-1 (2 μM), apoptosis inhibitor Z-VAD-FMK (5 μM), and necrosis inhibitor Necrostatin-1 (2 μM) on the proliferation capacity of FAM60A knockdown AsPC-1 cells; n = 3. (C) Heatmap of ferroptosis-related genes changes in RNA-Seq data. (D) Transmission electron microscopy to observe the effect of FAM60A knockdown on mitochondrial morphology in PDAC cells. (E) Effect of FAM60A knockdown on ROS content in PDAC cells; n = 3. (F) Effect of FAM60A knockdown on GSH/GSSG content in PDAC cells; n = 3. (G) Western blotting experiment examined the effect of FAM60A knockdown on GPX4 protein expression levels. (H) Western blotting experiment examined the effect of FAM60A knockdown on ACSL4 protein expression levels. ***P < 0.001, **P < 0.01, *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38314086), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Knockdown Validated: FAM60A Antibody - Azide and BSA Free [H00058516-B02P] -
FAM60A knockdown prevents PDAC tumor growth and promotes gemcitabine sensitivity. (A) The efficiency of FAM60A knockdown by transfecting siRNAs was evaluated by qRT-PCR; n = 3. (B) CCK-8 experiments detected the efficiency of using siRNAs knockdown FAM60A on cell proliferation; n = 3. (C) Western blotting experiments verified the efficiency of knockdown FAM60A by shRNA. (D) Plate clonal formation experiments detected the effect of FAM60A stable knockdown on cell survival; n = 3. (E) Cell viability was measured in sh-FAM60A-NC, sh-FAM60A-1, and sh-FAM60A-2 cells treated with the 10 nM gemcitabine (Gem); n = 3. (F) Examples of bioluminescent pictures taken from luciferase-expressing Capan-1 cells that were orthotopically implanted into nude mice treated with 0.9% sodium chloride or gemcitabine (50 mg/kg). (G) Quantification of mice’s flux luminescence is conducted with IVIS. (H) Survival curves of mice implanted with sh-FAM60A-NC or sh-FAM60A-1 cells respectively treated with NaCl or gemcitabine and 0.9% NaCl (n = 5). ***P < 0.001, **P < 0.01, *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38314086), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for FAM60A Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Knockdown Validated
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Immunohistochemistry and knockdown validation (PMID: 31727367).
Formulation, Preparation, and Storage
Purification
Protein G purified
Formulation
PBS (pH 7.4)
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: FAM60A
Alternate Names
C12orf14, chromosome 12 open reading frame 14, family with sequence similarity 60, member A, TERA, Tera protein homolog
Gene Symbol
SINHCAF
UniProt
Additional FAM60A Products
Product Documents for FAM60A Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FAM60A Antibody - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for FAM60A Antibody - Azide and BSA Free
Customer Reviews for FAM60A Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review FAM60A Antibody - Azide and BSA Free and earn rewards!
Have you used FAM60A Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...