FAM98B Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83475
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (90%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAI
Reactivity Notes
Reactivity reported in scientific literature (PMID: 24608264)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for FAM98B Antibody - BSA Free
Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475]
Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475]
Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human colon.Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475]
Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human testis.Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475]
Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475]
Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human cerebral cortex, gastrointestinal, skeletal muscle and testis using Anti-FAM98B antibody NBP1-83475 (A) shows similar protein distribution across tissues to independent antibody NBP1-83474 (B).Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475]
Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human colon shows strong nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475]
Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human parathyroid gland shows strong nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475]
Immunohistochemistry-Paraffin: FAM98B Antibody [NBP1-83475] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.Western Blot: FAM98B Antibody [NBP1-83475] -
Western Blot: FAM98B Antibody [NBP1-83475] - RTCB is required for induction of XBP1s during plasma cell differentiationB220+ splenocytes of control (Rtcbfl/fl or Rtcbfl/+), Rtcbfl/+Cd23-Cre or Rtcbfl/flCd23-Cre mice were stimulated with 20 μg/ml LPS for 4 days.A, B Protein levels of RTCB, tRNA ligase complex members (DDX1, FAM98B, CGI-99) & XBP1 were monitored by Western blot analysis (n > 3).C FACS-sorted CD138+ CD22− plasmablasts or CD138− CD22low pre-plasmablasts were probed for expression of the indicated proteins by Western blot analysis (n = 2).D Relative mRNA levels of Rtcb, Xbp1s, total Xbp1, Edem1, μM & μS were analyzed by RT–qPCR in fractionated LPS-stimulated cells at day 4 (n = 4, mean expression levels & SEM are displayed). Expression levels were normalized to Actb mRNA levels & to B cells from control mice. An unpaired Student's t-test was used to analyze the statistical significance of differences in mRNA levels (*P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/25378478), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for FAM98B Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 25378478). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: FAM98B
Alternate Names
family with sequence similarity 98, member B, FLJ38426
Gene Symbol
FAM98B
Additional FAM98B Products
Product Documents for FAM98B Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FAM98B Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for FAM98B Antibody - BSA Free
Customer Reviews for FAM98B Antibody - BSA Free
There are currently no reviews for this product. Be the first to review FAM98B Antibody - BSA Free and earn rewards!
Have you used FAM98B Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...