FAT10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13498

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: NASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FAT10 Antibody - BSA Free

Western Blot: FAT10 Antibody [NBP2-13498]

Western Blot: FAT10 Antibody [NBP2-13498]

Western Blot: FAT10 Antibody [NBP2-13498] - Analysis in control (vector only transfected HEK293T lysate) and UBD over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: FAT10 Antibody [NBP2-13498]

Immunocytochemistry/ Immunofluorescence: FAT10 Antibody [NBP2-13498]

Immunocytochemistry/Immunofluorescence: FAT10 Antibody [NBP2-13498] - Staining of human cell line Hep G2 shows localization to nucleus. Antibody staining is shown in green.
FAT10 Antibody

Immunohistochemistry: FAT10 Antibody [NBP2-13498] -

Immunohistochemistry for IL-10 and ubiquitin D (UBD) in rectal biopsies before (0) and after 7 days (VII) of daily tenofovir 1% gel use.Individual study participants are designated by letters. Blue indicates nuclei, brown indicates IL-10 or UBD.DOI:https://dx.doi.org/10.7554/eLife.04525.008
FAT10 Antibody

Immunohistochemistry: FAT10 Antibody [NBP2-13498] -

Immunohistochemistry: FAT10 Antibody [NBP2-13498] - Immunohistochemistry for IL-10 & ubiquitin D (UBD) in rectal biopsies before (0) & after 7 days (VII) of daily tenofovir 1% gel use.Individual study participants are designated by letters. Blue indicates nuclei, brown indicates IL-10 or UBD.DOI:http://dx.doi.org/10.7554/eLife.04525.008 Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/25647729), licensed under a CC0-1.0 license. Not internally tested by Novus Biologicals.
FAT10 Antibody - BSA Free Western Blot: FAT10 Antibody - BSA Free [NBP2-13498]

Western Blot: FAT10 Antibody - BSA Free [NBP2-13498]

Analysis in control (vector only transfected HEK293T lysate) and UBD over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for FAT10 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC reported in scientific literature (PMID: 25647729).

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAT10

Human Leukocyte Antigen-F Associated Transcript 10 (FAT10), also known as Ubiquitin D (UBD), is a 165 amino acid (aa) member of the Ubiquitin-like family of proteins. Human FAT10 has a predicted molecular weight of 18.5 kDa and shares 69% aa sequence identity with mouse FAT10. Human FAT10 mRNA is expressed as a single transcript in lymphoblastoid lines and dendritic cells, but more than one mRNA transcript has been identified for murine FAT10. FAT10 can also be induced by IFN-gamma and TNF-alpha in some cell lines. Structurally, FAT10 consists of two Ubiquitin-like domains that are connected by a short linker. Like Ubiquitin, FAT10 has a C-terminal glycine residue that can be used to form isopeptide bonds with target proteins. FAT10-conjugated proteins are targeted to the proteasome where the 26S Proteasome subunit S5a/Angiocidin binds to FAT10 and enables subsequent degradation of the conjugated protein. In addition to S5a/Angiocidin, FAT10 has been shown to interact with Huntingtin, Ataxin-1, MAD2, and NUB1L. FAT10 has been implicated in a number of biological processes such as cell cycle control, antigen presentation, and cytokine response.

Alternate Names

UBD

Gene Symbol

UBD

Additional FAT10 Products

Product Documents for FAT10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FAT10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FAT10 Antibody - BSA Free

Customer Reviews for FAT10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAT10 Antibody - BSA Free and earn rewards!

Have you used FAT10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...