FDX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38946

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FDX1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: WLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FDX1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining in human adrenal gland and cerebral cortex tissues using anti-FDX1 antibody. Corresponding FDX1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human adrenal gland, cerebral cortex, colon and lymph node using Anti-FDX1 antibody NBP2-38946 (A) shows similar protein distribution across tissues to independent antibody NBP1-89227 (B).
Immunocytochemistry/ Immunofluorescence: FDX1 Antibody [NBP2-38946]

Immunocytochemistry/ Immunofluorescence: FDX1 Antibody [NBP2-38946]

Immunocytochemistry/Immunofluorescence: FDX1 Antibody [NBP2-38946] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human lymph node.
Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946]

Immunohistochemistry-Paraffin: FDX1 Antibody [NBP2-38946] - Staining of human colon.

Applications for FDX1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FDX1

The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific. [provided by RefSeq]

Alternate Names

Adrenal ferredoxin, adrenodoxin, mitochondrial, ADXhepatoredoxin, FDX, ferredoxin 1, ferredoxin-1, Hepatoredoxin, LOH11CR1D, mitochondrial adrenodoxin

Gene Symbol

FDX1

UniProt

P10109 (Human)

Additional FDX1 Products

Product Documents for FDX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FDX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FDX1 Antibody - BSA Free

Customer Reviews for FDX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FDX1 Antibody - BSA Free and earn rewards!

Have you used FDX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies