FGF-4 (Fibroblast Growth Factor-4), also known as FGF-K and K-FGF, is a secreted angiogenic factor that is mitogenic for fibroblasts and endothelial cells. During development, it is required for maintenance of the trophoectoderm and primitive endoderm, and it cooperates with FGF-8 in the apical ectodermal ridge. FGF-4 promotes embryonic stem cell proliferation and may also aid stem cell differentiation. A C-terminally truncated 15 kDa isoform that opposes full-length FGF-4 and promotes differentiation is endogenously expressed in human embryonic stem cells.
FGF-4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83291
![Immunohistochemistry-Paraffin: FGF-4 Antibody [NBP1-83291]](https://resources.rndsystems.com/images/products/FGF-4-Antibody-Immunohistochemistry-Paraffin-NBP1-83291-img0002.jpg "Immunohistochemistry-Paraffin: FGF-4 Antibody [NBP1-83291]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit FGF-4 Antibody - BSA Free (NBP1-83291) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for FGF-4 Antibody - BSA Free
Immunohistochemistry-Paraffin: FGF-4 Antibody [NBP1-83291]
Immunohistochemistry-Paraffin: FGF-4 Antibody [NBP1-83291] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts and leydig cells.![FGF-4 Antibody - BSA Free Western Blot: FGF-4 Antibody - BSA Free [NBP1-83291]](https://resources.rndsystems.com/images/products/nbp1-83291_rabbit-polyclonal-fgf-4-antibody-8420251775420.jpg "Western Blot: FGF-4 Antibody - BSA Free [NBP1-83291]")
Western Blot: FGF-4 Antibody - BSA Free [NBP1-83291]
Analysis in control (vector only transfected HEK293T lysate) and FGF4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).Applications for FGF-4 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: FGF-4
Long Name
Fibroblast Growth Factor 4
Alternate Names
FGF4, HBGF-4, HST-1, KFGF, KS3
Gene Symbol
FGF4
Additional FGF-4 Products
Product Documents for FGF-4 Antibody - BSA Free
Product Specific Notices for FGF-4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for FGF-4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review FGF-4 Antibody - BSA Free and earn rewards!
Have you used FGF-4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for FGF-4 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I have just apllied FGF4 to oral tissue and have seen cell surface staining and cytoplasmic. Is this true?
A: FGF4 is a secreted protein. It binds to its receptor on the cell surface and the receptor and ligand are known to translocate to the cytomplasm and nucleus. The staining you are seeing sounds like it is correct.
