FGF-8 Antibody (2A10) - Azide and BSA Free

Novus Biologicals | Catalog # H00002253-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2A10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

FGF8 (NP_149354, 65 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

FGF8 (2A10)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for FGF-8 Antibody (2A10) - Azide and BSA Free

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in NIH/3T3.
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in PC-12.
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10 Analysis of FGF8 expression in HepG2.
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in Raw 264.7.
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in Jurkat.
Sandwich ELISA: FGF-8 Antibody (2A10) [H00002253-M01] - Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.

Applications for FGF-8 Antibody (2A10) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: FGF-8

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants.

Long Name

Fibroblast Growth Factor 8

Alternate Names

AIGF, FGF8, HBGF-8

Entrez Gene IDs

2253 (Human)

Gene Symbol

FGF8

OMIM

600483 (Human)

UniProt

Additional FGF-8 Products

Product Documents for FGF-8 Antibody (2A10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGF-8 Antibody (2A10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FGF-8 Antibody (2A10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FGF-8 Antibody (2A10) - Azide and BSA Free and earn rewards!

Have you used FGF-8 Antibody (2A10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies