FGF activity is mediated by a family of type I transmembrane tyrosine kinases, which undergo dimerization and autophosphorylation after ligand binding. Five distinct genes encode closely related FGF receptors, FGFR1 through 5. FGFRs contain three Ig-like domains and a stretch of acidic residues between the first and second Ig-like domains. FGFR1, 2, 3, and -4 have a cytoplasmic split tyrosine-kinase domain, but FGFR5 does not. Multiple forms of FGFR1, 2, and 3 are generated by alternative splicing.
FGFR1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-33784
![Western Blot: FGFR1 Antibody [NBP2-33784]](https://resources.rndsystems.com/images/products/FGF-R1-Antibody-Western-Blot-NBP2-33784-img0003.jpg "Western Blot: FGFR1 Antibody [NBP2-33784]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for FGFR1 Antibody - BSA Free
Western Blot: FGFR1 Antibody [NBP2-33784]
Western Blot: FGFR1 Antibody [NBP2-33784] - Analysis in human cell line AN3-CA.![Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784]](https://resources.rndsystems.com/images/products/FGF-R1-Antibody-Immunohistochemistry-Paraffin-NBP2-33784-img0001.jpg "Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784]")
Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784]
Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784] - Staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784] -
Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784] -
Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784] - Staining of human small intestine shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784] -
Immunohistochemistry-Paraffin: FGFR1 Antibody [NBP2-33784] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: FGFR1 Antibody - BSA Free [NBP2-33784] -
Genes co-expressed with TTYH3 and related pathways in bladder cancer. (A) UALCAN analysis of the profile of genes co-expressed with TTYH3. (B–F) Profiles of genes co-expressed with TTYH3 involved in signaling pathways in bladder urothelial carcinoma (BLCA). This figure depicts the results showing the gene ontology (GO) and signaling pathways of TTYH3, and the positively correlated genes in bladder cancer. The bar graphs represent genes positively correlated to TTYH3, showing the involvement in BLCA in pathway analysis performed using Enricher. The bar graph represents the ratio of the percent composition of terms in proteomic data vs. percent composition in the genome annotation. The length of the bar represents the significance of that specific gene-set or term. (G) Western blot analysis of mitogen-activated protein kinase (MAPK) signaling and FGFR1 proteins in TTYH3-knockdown bladder cancer cell lines. alpha -tubulin expression was used as the control. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36142409), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for FGFR1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: FGFR1
Long Name
Fibroblast Growth Factor Receptor 1
Alternate Names
CD331, FGF R1, Flt-2
Gene Symbol
FGFR1
UniProt
Additional FGFR1 Products
Product Documents for FGFR1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FGFR1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for FGFR1 Antibody - BSA Free
Powered by Bioz
Customer Reviews for FGFR1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review FGFR1 Antibody - BSA Free and earn rewards!
Have you used FGFR1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for FGFR1 Antibody - BSA Free
Showing
1
-
2 of
2 FAQs
Showing All
-
Q: I am working in Multiple sclerosis group and mainly working with mice model and cell culture study. I need FGFR1 antibody against Mice for FACS analysis. If it is available can I get the sample to check with my cells? And any Oligodendrocyte markers against mice for FACS too.
A: We do have an antibody that has been tested in FLOW, NB600-1287, however it has not been tested in mouse. If you would like to test this antibody in mouse samples we have an Innovators Reward Program where we reward you for trying our antibody in species and applications that have not been previously tested.
-
Q: I would like to inquire whether you have samples of the following antibodies: NBP1-61338, NB600-1287, NBP1-19481, NBP1-19864; The datasheets for these antibodies show different molecular weights of the detected proteins so its no altogether clear to me which one detects the real protein. To sort this out, we would be using FGFR1-deficient cells and would very much appreciate if you could supply us with small aliquots of these antibodies.
A: FGFR1 has multiple isoforms and is subject to multiple PTM's. The molecular weight can vary greatly depending on experimental conditions and samples used. We fully guarantee all of our products for the listed applications and species. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Due to our 100% guarantee, we do not offer free of charge samples of our products. If a smaller sample size is available, it will be listed on our product page.
-
Q: I am working in Multiple sclerosis group and mainly working with mice model and cell culture study. I need FGFR1 antibody against Mice for FACS analysis. If it is available can I get the sample to check with my cells? And any Oligodendrocyte markers against mice for FACS too.
A: We do have an antibody that has been tested in FLOW, NB600-1287, however it has not been tested in mouse. If you would like to test this antibody in mouse samples we have an Innovators Reward Program where we reward you for trying our antibody in species and applications that have not been previously tested.
-
Q: I would like to inquire whether you have samples of the following antibodies: NBP1-61338, NB600-1287, NBP1-19481, NBP1-19864; The datasheets for these antibodies show different molecular weights of the detected proteins so its no altogether clear to me which one detects the real protein. To sort this out, we would be using FGFR1-deficient cells and would very much appreciate if you could supply us with small aliquots of these antibodies.
A: FGFR1 has multiple isoforms and is subject to multiple PTM's. The molecular weight can vary greatly depending on experimental conditions and samples used. We fully guarantee all of our products for the listed applications and species. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Due to our 100% guarantee, we do not offer free of charge samples of our products. If a smaller sample size is available, it will be listed on our product page.
Loading...
Associated Pathways
Neural Stem Cell Differentiation Pathways & Lineage-specific Markers
