Fibrinopeptide A Antibody (7K8J1)

Novus Biologicals | Catalog # NBP3-15843

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7K8J1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Fibrinopeptide A (FGA) (P02671). NDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Fibrinopeptide A Antibody (7K8J1)

Western Blot: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843]

Western Blot: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843]

Western Blot: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843] - Analysis of extracts of various cell lines, using Fibrinopeptide A (FGA) Rabbit mAb (NBP3-15843) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843]

Immunohistochemistry-Paraffin: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843]

Immunohistochemistry-Paraffin: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843] - Mouse lung using Fibrinopeptide A (FGA) Rabbit mAb (NBP3-15843) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843]

Immunohistochemistry-Paraffin: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843]

Immunohistochemistry-Paraffin: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843] - Rat lung using Fibrinopeptide A (FGA) Rabbit mAb (NBP3-15843) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843]

Immunohistochemistry-Paraffin: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843]

Immunohistochemistry-Paraffin: Fibrinopeptide A Antibody (7K8J1) [NBP3-15843] - Human placenta using Fibrinopeptide A (FGA) Rabbit mAb (NBP3-15843) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Fibrinopeptide A Antibody (7K8J1)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Fibrinogen A

Alternate Names

FGA, Fib2, Fibrinogen alpha chain, Fibrinogen alpha subunit, Fibrinogen Type I, FPA

Gene Symbol

FGA

Additional Fibrinogen A Products

Product Documents for Fibrinopeptide A Antibody (7K8J1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fibrinopeptide A Antibody (7K8J1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fibrinopeptide A Antibody (7K8J1)

There are currently no reviews for this product. Be the first to review Fibrinopeptide A Antibody (7K8J1) and earn rewards!

Have you used Fibrinopeptide A Antibody (7K8J1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...