Flt-3/Flk-2/CD135 Antibody - BSA Free

Name: Flt-3/Flk-2/CD135 Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP2-57187
Price: 469 USD
Availability: InStock

Novus Biologicals | Catalog # NBP2-57187

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all Flt-3/Flk-2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Flt-3/Flk-2/CD135 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Flt-3/Flk-2/CD135 Antibody [NBP2-57187]

Immunocytochemistry/Immunofluorescence: Flt-3/Flk-2/CD135 Antibody [NBP2-57187] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Applications for Flt-3/Flk-2/CD135 Antibody - BSA Free

Application

Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Application Notes

ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Flt-3/Flk-2

Stem cell tyrosine kinase (STK-1) has been cloned from a CD34+ hematopoietic stem cell enriched library and identified as the human homolog of a previously identified gene of mouse origin designated either Flk-2 or Flt-3. The STK-1 cDNA encodes a protein of 993 amino acids with 85% identity to Flt-3/Flk-2. STK-1 is a member of the type III receptor tyrosine kinase family that includes Kit (steel factor receptor), Fms and PDGF. STK-1 expression in blood and marrow is restricted to CD34+ cells, a population greatly enriched for hematopoietic stem/progenitor cells. STK-1 antiserum recognizes two polypeptides in these cells. The mouse homolog of STK-1, designated Flt-3/ Flk-2, is expressed at high levels in hematopoietic cells and also in neural, gonadal, hepatic and placental tissues. It has been suggested that STK-1 and its murine homolog Flt-3/ Flk-2 may function as growth factor receptors on hematopoietic stem and/or progenitor cells.

Long Name

fms-like Tyrosine Kinase 3

Alternate Names

CD135, Flk-2, Flt3, STK-1

Gene Symbol

FLT3

Additional Flt-3/Flk-2 Products

Product Documents for Flt-3/Flk-2/CD135 Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Flt-3/Flk-2/CD135 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.