FOXI1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49660

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FOXI1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Analysis in human kidney and liver tissues. Corresponding FOXI1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: FOXI1 Antibody [NBP2-49660]

Immunocytochemistry/ Immunofluorescence: FOXI1 Antibody [NBP2-49660]

Immunocytochemistry/Immunofluorescence: FOXI1 Antibody [NBP2-49660] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.
Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Staining of human kidney shows moderate nuclear positivity in a subset of cells in tubules.
Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Staining of human salivary gland shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660]

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for FOXI1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FOXI1

FOXI1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

FKHL10HFH3, forkhead box I1, forkhead box protein I1, forkhead-like 10, forkhead-related activator 6, Forkhead-related protein FKHL10, Forkhead-related transcription factor 6, FREAC-6, FREAC6FKH10, Hepatocyte nuclear factor 3 forkhead homolog 3, HFH-3, HNF-3/fork-head homolog 3, HNF-3/fork-head homolog-3, MGC34197

Gene Symbol

FOXI1

Additional FOXI1 Products

Product Documents for FOXI1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FOXI1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FOXI1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FOXI1 Antibody - BSA Free and earn rewards!

Have you used FOXI1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...