FRYL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-94071

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FRYL Antibody - BSA Free

Western Blot: FRYL Antibody [NBP1-94071]

Western Blot: FRYL Antibody [NBP1-94071]

Western Blot: FRYL Antibody [NBP1-94071] - Analysis in human cell line HEL.
Immunohistochemistry-Paraffin: FRYL Antibody [NBP1-94071]

Immunohistochemistry-Paraffin: FRYL Antibody [NBP1-94071]

Immunohistochemistry-Paraffin: FRYL Antibody [NBP1-94071] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: FRYL Antibody [NBP1-94071]

Western Blot: FRYL Antibody [NBP1-94071]

Western Blot: FRYL Antibody [NBP1-94071] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: FRYL Antibody [NBP1-94071]

Immunohistochemistry-Paraffin: FRYL Antibody [NBP1-94071]

Immunohistochemistry-Paraffin: FRYL Antibody [NBP1-94071] - Staining of human cerebral cortex shows moderate cytoplsmic positivity in neuropil.
FRYL Antibody - BSA Free Western Blot: FRYL Antibody - BSA Free [NBP1-94071]

Western Blot: FRYL Antibody - BSA Free [NBP1-94071]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
FRYL Antibody - BSA Free Immunohistochemistry: FRYL Antibody - BSA Free [NBP1-94071]

Immunohistochemistry: FRYL Antibody - BSA Free [NBP1-94071]

Staining of human duodenum shows strong positivity in apical membrane in glandular cells.
FRYL Antibody - BSA Free Western Blot: FRYL Antibody - BSA Free [NBP1-94071]

Western Blot: FRYL Antibody - BSA Free [NBP1-94071]

Analysis in human cell line HEL.
FRYL Antibody - BSA Free Immunohistochemistry: FRYL Antibody - BSA Free [NBP1-94071]

Immunohistochemistry: FRYL Antibody - BSA Free [NBP1-94071]

Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
FRYL Antibody - BSA Free Immunohistochemistry: FRYL Antibody - BSA Free [NBP1-94071]

Immunohistochemistry: FRYL Antibody - BSA Free [NBP1-94071]

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
FRYL Antibody - BSA Free Immunohistochemistry: FRYL Antibody - BSA Free [NBP1-94071]

Immunohistochemistry: FRYL Antibody - BSA Free [NBP1-94071]

Staining of human liver shows no positivity in hepatocytes as expected.
FRYL Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: FRYL Antibody [NBP1-94071]

Immunocytochemistry/ Immunofluorescence: FRYL Antibody [NBP1-94071]

Staining of human cell line U-251 MG shows localization to cytosol & microtubules.

Applications for FRYL Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FRYL

Alternate Names

AF4P12, ALL1-fused gene from chromosome 4p12 protein, DKFZp686E205, FLJ16177, FRY-like, furry homolog-like, furry-like, KIAA0826, protein furry homolog-like

Gene Symbol

FRYL

Additional FRYL Products

Product Documents for FRYL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FRYL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FRYL Antibody - BSA Free

Customer Reviews for FRYL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FRYL Antibody - BSA Free and earn rewards!

Have you used FRYL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...