FTO Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58941

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FTO Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit FTO Antibody - BSA Free (NBP2-58941) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for FTO Antibody - BSA Free

Western Blot: FTO Antibody [NBP2-58941]

Western Blot: FTO Antibody [NBP2-58941]

Western Blot: FTO Antibody [NBP2-58941] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941]

Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941]

Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941] - Staining in human parathyroid gland and pancreas tissues using anti-FTO antibody. Corresponding FTO RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941]

Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941]

Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941]

Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941]

Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941] - Staining of human parathyroid gland shows high expression.

Applications for FTO Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FTO

Fat mass and obesity-associated protein (FTO) is a novel protein and a member of the non-heme dioxygenase (Fe(II)- and 2-oxoglutarate-dependent dioxygenases) superfamily. Though not much is yet known about FTO, it is thought that the protein may somehow modify the activity of genes involved in metabolism and fat storage, which in turn may influence a person's risk of obesity.

FTO antibodies are useful tools for lipid metabolism research and obesity studies.

Long Name

Fat Mass and Obesity Associated

Alternate Names

Alpha-ketoglutarate-dependent dioxygenase FTO

Gene Symbol

FTO

Additional FTO Products

Product Documents for FTO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FTO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Diabetes
Obesity

Customer Reviews for FTO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FTO Antibody - BSA Free and earn rewards!

Have you used FTO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FTO Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Do you have any antibodies against FTO, where you can indicate the sequence of the immunogen?

    A: With regards to other FTO antibodies that we do list the peptide sequence for, the immunogen sequence for catalog number NB110-60935 can be found in the range of amino acids 400-505. Many of the exact immunogen sequences used for our products are proprietary and cannot be disclosed. In these instances we try to provide a reasonable amino acid range to help in your decision.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies