FXR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89546

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FXR1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FXR1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: FXR1 Antibody [NBP1-89546]

Immunocytochemistry/ Immunofluorescence: FXR1 Antibody [NBP1-89546]

Immunocytochemistry/Immunofluorescence: FXR1 Antibody [NBP1-89546] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546]

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546]

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546]

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546]

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546]

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546]

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546]

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546]

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.
Simple Western: FXR1 Antibody [NBP1-89546]

Simple Western: FXR1 Antibody [NBP1-89546]

Simple Western: FXR1 Antibody [NBP1-89546] - Simple Western lane view shows a specific band for FXR1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: FXR1 Antibody [NBP1-89546]

Simple Western: FXR1 Antibody [NBP1-89546]

Simple Western: FXR1 Antibody [NBP1-89546] - Electropherogram image(s) of corresponding Simple Western lane view. FXR1 antibody was used at 1:100 dilution on RT-4 and U-251MG sp lysates(s).
FXR1 Antibody - BSA Free Western Blot: FXR1 Antibody - BSA Free [NBP1-89546]

Western Blot: FXR1 Antibody - BSA Free [NBP1-89546]

Analysis in human cell line U-251 MG.
FXR1 Antibody - BSA Free Western Blot: FXR1 Antibody - BSA Free [NBP1-89546]

Western Blot: FXR1 Antibody - BSA Free [NBP1-89546]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for FXR1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:100

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:100, apparent MW was 68 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FXR1

FXR1 is encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.

Alternate Names

fragile X mental retardation syndrome-related protein 1, fragile X mental retardation, autosomal homolog 1, FXR1P, hFXR1p

Gene Symbol

FXR1

Additional FXR1 Products

Product Documents for FXR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FXR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FXR1 Antibody - BSA Free

Customer Reviews for FXR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FXR1 Antibody - BSA Free and earn rewards!

Have you used FXR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies