GABPA Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84941

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GABPA Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTECEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GABPA Antibody - BSA Free

Western Blot: GABPA Antibody [NBP1-84941]

Western Blot: GABPA Antibody [NBP1-84941]

Western Blot: GABPA Antibody [NBP1-84941] - Analysis in control (vector only transfected HEK293T lysate) and GABPA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: GABPA Antibody [NBP1-84941]

Immunocytochemistry/ Immunofluorescence: GABPA Antibody [NBP1-84941]

Immunocytochemistry/Immunofluorescence: GABPA Antibody [NBP1-84941] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GABPA Antibody [NBP1-84941]

Immunohistochemistry-Paraffin: GABPA Antibody [NBP1-84941]

Immunohistochemistry-Paraffin: GABPA Antibody [NBP1-84941] - Staining of human esophagus shows moderate nuclear positivity in squamous epithelial cells.

Applications for GABPA Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GABPA

GABPA encodes one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. This subunit also shares identity with a subunit constituting the transcription factor E4TF1, responsible for expression of the adenovirus E4 gene. Because of its chromosomal localization and ability to form heterodimers with other polypeptides, this gene may play a role in the Down Syndrome phenotype.

Alternate Names

E4TF1-60, E4TF1ATranscription factor E4TF1-60, GA binding protein transcription factor, alpha subunit 60kDa, GA-binding protein alpha chain, GA-binding protein transcription factor, alpha subunit (60kD), GABP subunit alpha, human nuclear respiratory factor-2 subunit alpha, 10, NFT2, NRF2, NRF2A, nuclear respiratory factor 2 alpha subunit, Nuclear respiratory factor 2 subunit alpha

Gene Symbol

GABPA

Additional GABPA Products

Product Documents for GABPA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GABPA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GABPA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GABPA Antibody - BSA Free and earn rewards!

Have you used GABPA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies