GADD45G Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35120

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1).

Sequence:
IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GADD45G Antibody - BSA Free

GADD45G Antibody

Western Blot: GADD45G Antibody [NBP3-35120] -

Western Blot: GADD45G Antibody [NBP3-35120] - Western blot analysis of lysates from RAW264.7 cells, using GADD45G Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5min.
GADD45G Antibody

Immunohistochemistry: GADD45G Antibody [NBP3-35120] -

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
GADD45G Antibody

Immunohistochemistry: GADD45G Antibody [NBP3-35120] -

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Mouse pancreas tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
GADD45G Antibody

Immunohistochemistry: GADD45G Antibody [NBP3-35120] -

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
GADD45G Antibody

Immunohistochemistry: GADD45G Antibody [NBP3-35120] -

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
GADD45G Antibody

Immunohistochemistry: GADD45G Antibody [NBP3-35120] -

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for GADD45G Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GADD45 gamma

GADD45G is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.

Long Name

Growth Arrest and DNA Damage Gene gamma

Alternate Names

GADD45g

Gene Symbol

GADD45G

Additional GADD45 gamma Products

Product Documents for GADD45G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GADD45G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GADD45G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GADD45G Antibody - BSA Free and earn rewards!

Have you used GADD45G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...