Galectin-10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87688

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Galectin-10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Galectin-10 Antibody - BSA Free

Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688]

Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688]

Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688] - Staining in human bone marrow and cerebral cortex tissues using anti-CLC antibody. Corresponding CLC RNA-seq data are presented for the same tissues.
Western Blot: Galectin-10 Antibody [NBP1-87688]

Western Blot: Galectin-10 Antibody [NBP1-87688]

Western Blot: Galectin-10 Antibody [NBP1-87688] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line HL-60
Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688]

Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688]

Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688]

Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688]

Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688] - Staining of human bone marrow shows high expression.

Applications for Galectin-10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Galectin-10

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq]

Alternate Names

CLC, GAL10, Galectin10, LGALS10

Gene Symbol

CLC

Additional Galectin-10 Products

Product Documents for Galectin-10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Galectin-10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Lectins
NKG2D Receptors and Ligands

Customer Reviews for Galectin-10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Galectin-10 Antibody - BSA Free and earn rewards!

Have you used Galectin-10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Galectin-10 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: We ordered Galectin 10 Antibody (NBP1-87688) with the Lot-Nr. R38892. We just don't have the vial label any more. Could you please tell me the concentration of our lot?

    A: The concentration of NBP1-87688, lot number R38892 is 0.2 mg/ml.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies