gamma Catenin Antibody (9O2K8)

Novus Biologicals | Catalog # NBP3-16344

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9O2K8 expressed in HEK293
View all gamma Catenin Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 15-115 of human gamma Catenin (P14923). EWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for gamma Catenin Antibody (9O2K8)

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Western blot analysis of extracts of various cell lines, using gamma Catenin Rabbit mAb (NBP3-16344) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Western blot analysis of extracts of Rat heart, using gamma Catenin Rabbit mAb (NBP3-16344) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
gamma Catenin Antibody (9O2K8)

Immunocytochemistry/ Immunofluorescence: gamma Catenin Antibody (9O2K8) [NBP3-16344] -

Immunocytochemistry/ Immunofluorescence: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Immunofluorescence analysis of HeLa cells using gamma Catenin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
gamma Catenin Antibody (9O2K8)

Immunocytochemistry/ Immunofluorescence: gamma Catenin Antibody (9O2K8) [NBP3-16344] -

Immunocytochemistry/ Immunofluorescence: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Immunofluorescence analysis of NIH-3T3 cells using gamma Catenin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for gamma Catenin Antibody (9O2K8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: gamma Catenin

Catenin gamma, also known as Junction Plakoglobin, is a common junctional plaque protein. It is a cytoplasmic protein with soluble and membrane-associated forms. The presence of Catenin gamma in both the desmosomes and in the intermediate junctions suggests it has a role in the structure and Function of submembranous plaques.

Alternate Names

catenin (cadherin-associated protein), gamma (80kD), catenin (cadherin-associated protein), gamma 80kDa, Catenin gamma, Desmoplakin III, desmoplakin-3, DP3CTNNG, DPIII, gamma-catenin, junction plakoglobin, PDGBARVD12, PKGB

Gene Symbol

JUP

Additional gamma Catenin Products

Product Documents for gamma Catenin Antibody (9O2K8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for gamma Catenin Antibody (9O2K8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for gamma Catenin Antibody (9O2K8)

There are currently no reviews for this product. Be the first to review gamma Catenin Antibody (9O2K8) and earn rewards!

Have you used gamma Catenin Antibody (9O2K8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies