Gastric Lipase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91928

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Gastric Lipase Antibody - BSA Free

Western Blot: Gastric Lipase Antibody [NBP1-91928]

Western Blot: Gastric Lipase Antibody [NBP1-91928]

Western Blot: Gastric Lipase Antibody [NBP1-91928] - Analysis in control (vector only transfected HEK293T lysate) and LIPF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928]

Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928]

Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928] - Staining in human stomach and seminal vesicle tissues using anti-LIPF antibody. Corresponding LIPF RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928]

Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928]

Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928] - Staining of human stomach (lower) shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928]

Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928]

Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928] - Staining of human seminal vesicle shows low expression as expected.
Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928]

Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928]

Immunohistochemistry-Paraffin: Gastric Lipase Antibody [NBP1-91928] - Staining of human stomach shows high expression.
Gastric Lipase Antibody - BSA Free Immunohistochemistry: Gastric Lipase Antibody - BSA Free [NBP1-91928]

Immunohistochemistry: Gastric Lipase Antibody - BSA Free [NBP1-91928]

Analysis in human stomach and seminal vesicle tissues using Anti-LIPF antibody. Corresponding LIPF RNA-seq data are presented for the same tissues.
Gastric Lipase Antibody - BSA Free Immunohistochemistry: Gastric Lipase Antibody - BSA Free [NBP1-91928]

Immunohistochemistry: Gastric Lipase Antibody - BSA Free [NBP1-91928]

Staining of human seminal vesicle shows low expression as expected.
Gastric Lipase Antibody - BSA Free Immunohistochemistry: Gastric Lipase Antibody - BSA Free [NBP1-91928]

Immunohistochemistry: Gastric Lipase Antibody - BSA Free [NBP1-91928]

Staining of human stomach shows high expression.

Applications for Gastric Lipase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Gastric Lipase

Gastric Lipase encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism.

Long Name

Gastric triacylglycerol lipase

Alternate Names

GL, LIPF

Gene Symbol

LIPF

Additional Gastric Lipase Products

Product Documents for Gastric Lipase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Gastric Lipase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Gastric Lipase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Gastric Lipase Antibody - BSA Free and earn rewards!

Have you used Gastric Lipase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...