GBP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48771

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GBP2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GBP2 Antibody - BSA Free

Western Blot: GBP2 Antibody [NBP2-48771]

Western Blot: GBP2 Antibody [NBP2-48771]

Western Blot: GBP2 Antibody [NBP2-48771] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: GBP2 Antibody [NBP2-48771]

Immunocytochemistry/ Immunofluorescence: GBP2 Antibody [NBP2-48771]

Immunocytochemistry/Immunofluorescence: GBP2 Antibody [NBP2-48771] - Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: GBP2 Antibody [NBP2-48771]

Immunohistochemistry-Paraffin: GBP2 Antibody [NBP2-48771]

Immunohistochemistry-Paraffin: GBP2 Antibody [NBP2-48771] - Staining of human urinary bladder shows distinct cytoplasmic and nuclear positivity in urothelial cells.

Applications for GBP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GBP2

Interferons are cytokines that have antiviral effects and inhibit tumor cell proliferation. They induce a large number of genes in their target cells, including those coding for the guanylate-binding proteins (GBPs). GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). The protein encoded by this gene is a GTPase that converts GTP to GDP and GMP. [provided by RefSeq]

Alternate Names

GBP-2, GTP-binding protein 2, Guanine nucleotide-binding protein 2, guanylate binding protein 2, interferon-inducible, huGBP-2, interferon-induced guanylate-binding protein 2

Gene Symbol

GBP2

Additional GBP2 Products

Product Documents for GBP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GBP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GBP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GBP2 Antibody - BSA Free and earn rewards!

Have you used GBP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies