GCM1 Antibody (4E8) - Azide and BSA Free

Novus Biologicals | Catalog # H00008521-M04

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4E8

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*

Specificity

GCM1 - glial cells missing homolog 1 (Drosophila)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for GCM1 Antibody (4E8) - Azide and BSA Free

Western Blot: GCM1 Antibody (4E8) [H00008521-M04]

Western Blot: GCM1 Antibody (4E8) [H00008521-M04]

Western Blot: GCM1 Antibody (4E8) [H00008521-M04] - Analysis of GCM1 expression in FHs 173 WE.
Immunocytochemistry/ Immunofluorescence: GCM1 Antibody (4E8) [H00008521-M04]

Immunocytochemistry/ Immunofluorescence: GCM1 Antibody (4E8) [H00008521-M04]

Immunocytochemistry/Immunofluorescence: GCM1 Antibody (4E8) [H00008521-M04] - Analysis of monoclonal antibody to GCM1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: GCM1 Antibody (4E8) [H00008521-M04] - Detection limit for recombinant GST tagged GCM1 is approximately 0.1ng/ml as a capture antibody.

Applications for GCM1 Antibody (4E8) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for IF and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GCM1

This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.

Alternate Names

GCM motif protein 1, GCMA, glial cells missing (Drosophila) homolog a, Glial cells missing homolog 1, glial cells missing homolog 1 (Drosophila), hGCMachorion-specific transcription factor GCMa

Entrez Gene IDs

8521 (Human)

Gene Symbol

GCM1

OMIM

603715 (Human)

Additional GCM1 Products

Product Documents for GCM1 Antibody (4E8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GCM1 Antibody (4E8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GCM1 Antibody (4E8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GCM1 Antibody (4E8) - Azide and BSA Free and earn rewards!

Have you used GCM1 Antibody (4E8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...