GEM Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58906

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to GEM(GTP binding protein overexpressed in skeletal muscle) The peptide sequence was selected from the C terminal of GEM (NP_005252). Peptide sequence ETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFW The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24809506).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GEM Antibody - BSA Free

Western Blot: GEM Antibody [NBP1-58906]

Western Blot: GEM Antibody [NBP1-58906]

Western Blot: GEM Antibody [NBP1-58906] - Human Stomach Tumor cell lysate. Antibody at 1.0 ug/mL.
Immunohistochemistry: GEM Antibody [NBP1-58906]

Immunohistochemistry: GEM Antibody [NBP1-58906]

Immunohistochemistry: GEM Antibody [NBP1-58906] - Human kidney tissue section. Magnification: 400X.
Western Blot: GEM Antibody [NBP1-58906]

Western Blot: GEM Antibody [NBP1-58906]

Western Blot: GEM Antibody [NBP1-58906] - HepG2 cell lysate. Antibody at 2.5 ug/mL.
Immunohistochemistry-Paraffin: GEM Antibody [NBP1-58906]

Immunohistochemistry-Paraffin: GEM Antibody [NBP1-58906]

Immunohistochemistry-Paraffin: GEM Antibody [NBP1-58906] - Human Skin Cellular Data: Squamous epithelial tissue section. Magnification: 400X.

Applications for GEM Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10 - 1:500

Immunohistochemistry-Paraffin

4 - 8 ug/mL

Western Blot

1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence and Immunohistochemistry-Frozen reported in scientific literature (PMID 24809506).

Reviewed Applications

Read 1 review rated 4 using NBP1-58906 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GEM

GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Alternate Names

GTP binding protein overexpressed in skeletal muscle, GTP-binding mitogen-induced T-cell protein, GTP-binding protein GEM, GTP-binding protein overexpressed in skeletal muscle, kinase-inducible Ras-like protein, KIRMGC26294, RAS-like protein KIR

Entrez Gene IDs

2669 (Human)

Gene Symbol

GEM

UniProt

Additional GEM Products

Product Documents for GEM Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GEM Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GEM Antibody - BSA Free

Customer Reviews for GEM Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used GEM Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • GEM Antibody
    Name: Valeria Di Leo
    Application: Immunohistochemistry-Frozen
    Sample Tested: Skeletal muscle and Skeletal muscle tissue
    Species: Human
    Verified Customer | Posted 11/05/2020
    Human skeletal muscle (quadriceps) stained with anti-CCDC8 (green) and Hoechst (blue).
    Fixative: 4% paraformaldehyde Permeabilization: Methanol gradient (70% for 10 mins, 95% for 10 mins, 100% for 20 mins, 95% for 10 mins, 70% for 10 mins) Protein blocking: 10% NGS diluted in TBST Endogenous biotin blocking: Avidin D solution for 15 mins, Biotin for 15 mins (Vector Laboratories, Inc) Dilution: 1/50 Incubation time: 19 hour(s) and 0 minute(s) · Diluent TBST – NGS 10% Secondary antibody: Life tech/ThermoFisher, A11006, Alexa 488, anti-Rabbit isotype IgG, Host species: Goat, Clonality: Polyclonal
    GEM Antibody - BSA Free NBP1-58906

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...