Gemin 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55998

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAM

Reactivity Notes

Mouse 84%, Rat 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Gemin 4 Antibody - BSA Free

Western Blot: Gemin 4 Antibody [NBP2-55998]

Western Blot: Gemin 4 Antibody [NBP2-55998]

Western Blot: Gemin 4 Antibody [NBP2-55998] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Gemin 4 Antibody [NBP2-55998]

Immunocytochemistry/ Immunofluorescence: Gemin 4 Antibody [NBP2-55998]

Immunocytochemistry/Immunofluorescence: Gemin 4 Antibody [NBP2-55998] - Staining of human cell line A549 shows localization to nuclear bodies & cytosol.
Western Blot: Gemin 4 Antibody [NBP2-55998]

Western Blot: Gemin 4 Antibody [NBP2-55998]

Western Blot: Gemin 4 Antibody [NBP2-55998] - Analysis in human cell lines A-549 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Applications for Gemin 4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Gemin 4

The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes required for pre-mRNA splicing in the nucleus. The encoded protein directly interacts with a DEAD box protein and several spliceosome core proteins. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Alternate Names

component of gems 4, DKFZp434B131, DKFZP434D174, gem (nuclear organelle) associated protein 4, gemin-4, HC56, HCAP1, HCC-associated protein 1, HHRF-1, p97DKFZp434D174

Gene Symbol

GEMIN4

Additional Gemin 4 Products

Product Documents for Gemin 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Gemin 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Gemin 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Gemin 4 Antibody - BSA Free and earn rewards!

Have you used Gemin 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...