GGA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14047

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GGA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: PSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GGA1 Antibody - BSA Free

Western Blot: GGA1 Antibody [NBP2-14047]

Western Blot: GGA1 Antibody [NBP2-14047]

Western Blot: GGA1 Antibody [NBP2-14047] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: GGA1 Antibody [NBP2-14047]

Immunocytochemistry/ Immunofluorescence: GGA1 Antibody [NBP2-14047]

Immunocytochemistry/Immunofluorescence: GGA1 Antibody [NBP2-14047] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: GGA1 Antibody [NBP2-14047]

Immunohistochemistry-Paraffin: GGA1 Antibody [NBP2-14047]

Immunohistochemistry-Paraffin: GGA1 Antibody [NBP2-14047] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Applications for GGA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GGA1

GGA1 encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Alternate Names

ADP-ribosylation factor binding protein 1, ADP-ribosylation factor-binding protein GGA1, gamma adaptin ear containing, ARF binding protein 1, gamma-adaptin related protein 1, Gamma-adaptin-related protein 1, golgi-associated, gamma adaptin ear containing, ARF binding protein 1, Golgi-localized, gamma ear-containing, ARF-binding protein 1

Gene Symbol

GGA1

Additional GGA1 Products

Product Documents for GGA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GGA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GGA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GGA1 Antibody - BSA Free and earn rewards!

Have you used GGA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies