GIMAP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83778

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GIMAP4 Antibody - BSA Free

Western Blot: GIMAP4 Antibody [NBP1-83778]

Western Blot: GIMAP4 Antibody [NBP1-83778]

Western Blot: GIMAP4 Antibody [NBP1-83778] - Analysis in control (vector only transfected HEK293T lysate) and GIMAP4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778] - Staining of human testis.
Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778] - Staining in human lymph node and cerebral cortex tissues using anti-GIMAP4 antibody. Corresponding GIMAP4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778] - Staining of human cerebral cortex, lymph node, testis and tonsil using Anti-GIMAP4 antibody NBP1-83778 (A) shows similar protein distribution across tissues to independent antibody NBP1-83776 (B).
Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778]

Immunohistochemistry-Paraffin: GIMAP4 Antibody [NBP1-83778] - Staining of human tonsil.

Applications for GIMAP4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 23041938). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GIMAP4

GIMAP4 encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia 1 (TAL1). In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq]

Alternate Names

GTPase IMAP family member 4, GTPase, IMAP family member 4, HIMAP4, human immune associated nucleotide 1, IAN-1, IAN1FLJ11110, IMAP4hIAN1, immunity associated protein 4, Immunity-associated nucleotide 1 protein, Immunity-associated protein 4

Gene Symbol

GIMAP4

Additional GIMAP4 Products

Product Documents for GIMAP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GIMAP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GIMAP4 Antibody - BSA Free

Customer Reviews for GIMAP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GIMAP4 Antibody - BSA Free and earn rewards!

Have you used GIMAP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...